mat1a antibody Search Results


mat1a antibody (4d11)  (Bio-Techne corporation)
90
Bio-Techne corporation mat1a antibody (4d11)
Mat1a Antibody (4d11), supplied by Bio-Techne corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mat1a antibody (4d11)/product/Bio-Techne corporation
Average 90 stars, based on 1 article reviews
mat1a antibody (4d11) - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier
mat1a antibody  (Proteintech)
93
Proteintech mat1a antibody
Expression levels of CBS, ALDH2, AHCY, <t>MAT1A</t> and MTHFR proteins in liver tissues of rats in each group. (A) Expression levels of MAT1A protein in liver tissues of rats in each group (n = 3); (B) Expression levels of AHCY protein in liver tissues of rats in each group (n = 3); (C) Expression levels of MYHFR protein in liver tissues of rats in each group (n = 3); (D) Expression levels of ALDH2 protein in liver tissues of rats in each group (n = 3); (E) Expression levels of CBS protein in liver tissues of rats in each group (n = 3). Note: Data are expressed as the mean ± SD. “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.
Mat1a Antibody, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mat1a antibody/product/Proteintech
Average 93 stars, based on 1 article reviews
mat1a antibody - by Bioz Stars, 2026-05
93/100 stars
  Buy from Supplier
mat1a antibody  (Novus Biologicals)
91
Novus Biologicals mat1a antibody
GNMT , <t>MAT1A</t> and MAT2A mRNA expression from a published RNA-seq data set. ( A ) No difference was observed in GNMT ( A ) or MAT1A ( B ) mRNA expressions between breast cancer tissues and normal tissues, and no association was found in these genes with overall survival rate. ( C ) The median of MAT2A mRNA expression level in breast tumorous tissues tended to be lower in breast cancer compared to that of the normal tissues; however, a longer survival rate was found in patients with lower MAT2A mRNA levels of the tumor tissue, ( D ) No association was found between MAT2A mRNA expression and tumor stages.
Mat1a Antibody, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mat1a antibody/product/Novus Biologicals
Average 91 stars, based on 1 article reviews
mat1a antibody - by Bioz Stars, 2026-05
91/100 stars
  Buy from Supplier
sam synthase  (Novus Biologicals)
91
Novus Biologicals sam synthase
Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; <t>SAM,</t> S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM <t>synthase</t> (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.
Sam Synthase, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sam synthase/product/Novus Biologicals
Average 91 stars, based on 1 article reviews
sam synthase - by Bioz Stars, 2026-05
91/100 stars
  Buy from Supplier
polyclonal rabbit anti-human mat1a antibody  (WuXi AppTec)
90
WuXi AppTec polyclonal rabbit anti-human mat1a antibody
Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; <t>SAM,</t> S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM <t>synthase</t> (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.
Polyclonal Rabbit Anti Human Mat1a Antibody, supplied by WuXi AppTec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/polyclonal rabbit anti-human mat1a antibody/product/WuXi AppTec
Average 90 stars, based on 1 article reviews
polyclonal rabbit anti-human mat1a antibody - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier
rabbit polyclonal antibody against mat1a amino acids 208 to 228  (Cocalico Inc)
90
Cocalico Inc rabbit polyclonal antibody against mat1a amino acids 208 to 228
Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; <t>SAM,</t> S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM <t>synthase</t> (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.
Rabbit Polyclonal Antibody Against Mat1a Amino Acids 208 To 228, supplied by Cocalico Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/rabbit polyclonal antibody against mat1a amino acids 208 to 228/product/Cocalico Inc
Average 90 stars, based on 1 article reviews
rabbit polyclonal antibody against mat1a amino acids 208 to 228 - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier
sams 1  (Novus Biologicals)
90
Novus Biologicals sams 1
Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; <t>SAM,</t> S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM <t>synthase</t> (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.
Sams 1, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sams 1/product/Novus Biologicals
Average 90 stars, based on 1 article reviews
sams 1 - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier
mat1a antibody  (Biosynth Carbosynth)
N/A
MAT1A antibody was raised using the N terminal of MAT1A corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE. Rabbit polyclonal MAT1A antibody raised against the N terminal of MAT1A.
   Buy from Supplier
mat1a antibody (oaec04689)  (Aviva Systems)
N/A
This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylm ethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the
   Buy from Supplier
mat1a antibody  (Abbexa)
N/A
MAT1A Antibody is a Rabbit Polyclonal antibody against MAT1A This gene catalyzes a two step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S adenosylmethionine and tripolyphosphate which
   Buy from Supplier
methionine adenosyltransferase i alpha mat1a antibody  (Abbexa)
N/A
Methionine Adenosyltransferase I Alpha MAT1a Antibody is a Mouse Monoclonal antibody against Methionine Adenosyltransferase I Alpha MAT1a
   Buy from Supplier

Image Search Results


Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFR proteins in liver tissues of rats in each group. (A) Expression levels of MAT1A protein in liver tissues of rats in each group (n = 3); (B) Expression levels of AHCY protein in liver tissues of rats in each group (n = 3); (C) Expression levels of MYHFR protein in liver tissues of rats in each group (n = 3); (D) Expression levels of ALDH2 protein in liver tissues of rats in each group (n = 3); (E) Expression levels of CBS protein in liver tissues of rats in each group (n = 3). Note: Data are expressed as the mean ± SD. “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Journal: Frontiers in Pharmacology

Article Title: Effect of gentiopicroside on endogenous formaldehyde homocysteine–pathway related proteins in rats with non-alcoholic steatohepatitis

doi: 10.3389/fphar.2025.1700101

Figure Lengend Snippet: Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFR proteins in liver tissues of rats in each group. (A) Expression levels of MAT1A protein in liver tissues of rats in each group (n = 3); (B) Expression levels of AHCY protein in liver tissues of rats in each group (n = 3); (C) Expression levels of MYHFR protein in liver tissues of rats in each group (n = 3); (D) Expression levels of ALDH2 protein in liver tissues of rats in each group (n = 3); (E) Expression levels of CBS protein in liver tissues of rats in each group (n = 3). Note: Data are expressed as the mean ± SD. “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Article Snippet: ROS, GSH, MDA, SOD, SAH, SAM, GST, CAT, GSH, HCY were obtained from Jiangsu Enzyme Immunoassay Biotechnology Co., LTD. Their item numbers are MM-88564O1, MM-20251R1, MM-2037H1, MM-20387R1, MM-50456H1, MM-0248H1, MM-21254R1, MM-20447R1, MM-20251R1 and MM-50456H1. β-actin antibody (Proteintech, 20536-1-AP); ALDH2 antibody (Proteintech, 15310-1-AP); MAT1A antibody (Proteintech, 12395-1-AP); MTHFR antibody (Proteintech, 26591-1-AP); CBS antibody (Proteintech, 14787-1-AP); AHCY antibody (Proteintech, 10757-2-AP); PVDF membrane with a thickness of 0.45 μm (IPVH00010, Millipore); Universal total RNA extraction reagent (U7431, Suzhou Youyi Landi Biotechnology Co., LTD.) Taq SYBR® Green qPCR Premix (Universal) (EG0117M, Jiangsu Bishi Mei Biotechnology Co., LTD.) All-in-One First-Strand Synthesis MasterMix (with dsDNase) was obtained from Jiangsu Bestmate Biotechnology Co., LTD. (item number (EG15133S).

Techniques: Expressing

Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFRmRNA in liver tissues of rats in each group (A) Expression levels of ALDH2 mRNA in liver tissues of rats in each group (n = 3); (B) Expression levels of MTHFRmRNA in liver tissues of rats in each group (n = 3); (C) Expression levels of CBS mRNA in liver tissues of rats in each group (n = 3); (D) Expression levels of AHCY mRNA in liver tissues of rats in each group (n = 3); (E) Expression levels of MAT1A mRNA in liver tissues of rats in each group (n = 3). Note: “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Journal: Frontiers in Pharmacology

Article Title: Effect of gentiopicroside on endogenous formaldehyde homocysteine–pathway related proteins in rats with non-alcoholic steatohepatitis

doi: 10.3389/fphar.2025.1700101

Figure Lengend Snippet: Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFRmRNA in liver tissues of rats in each group (A) Expression levels of ALDH2 mRNA in liver tissues of rats in each group (n = 3); (B) Expression levels of MTHFRmRNA in liver tissues of rats in each group (n = 3); (C) Expression levels of CBS mRNA in liver tissues of rats in each group (n = 3); (D) Expression levels of AHCY mRNA in liver tissues of rats in each group (n = 3); (E) Expression levels of MAT1A mRNA in liver tissues of rats in each group (n = 3). Note: “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Article Snippet: ROS, GSH, MDA, SOD, SAH, SAM, GST, CAT, GSH, HCY were obtained from Jiangsu Enzyme Immunoassay Biotechnology Co., LTD. Their item numbers are MM-88564O1, MM-20251R1, MM-2037H1, MM-20387R1, MM-50456H1, MM-0248H1, MM-21254R1, MM-20447R1, MM-20251R1 and MM-50456H1. β-actin antibody (Proteintech, 20536-1-AP); ALDH2 antibody (Proteintech, 15310-1-AP); MAT1A antibody (Proteintech, 12395-1-AP); MTHFR antibody (Proteintech, 26591-1-AP); CBS antibody (Proteintech, 14787-1-AP); AHCY antibody (Proteintech, 10757-2-AP); PVDF membrane with a thickness of 0.45 μm (IPVH00010, Millipore); Universal total RNA extraction reagent (U7431, Suzhou Youyi Landi Biotechnology Co., LTD.) Taq SYBR® Green qPCR Premix (Universal) (EG0117M, Jiangsu Bishi Mei Biotechnology Co., LTD.) All-in-One First-Strand Synthesis MasterMix (with dsDNase) was obtained from Jiangsu Bestmate Biotechnology Co., LTD. (item number (EG15133S).

Techniques: Expressing

The mechanism diagram of endogenous formaldehyde participating in one-carbon metabolism leading to homocysteine accumulation and causing NASH. Note: formaldehyde (Endogenous FA); Glutathione (GSH) Mitochondrial aldehyde dehydrogenase 2 (ALDH2); Formate; Tetrahydrofolate (THF); 5, 10-methylenetetrahydrofolate (5, 10-CH2-THF); Methylenetetrahydrofolate reductase (MTHFR); Homocysteine (HCY); S-adenosine homocysteine (SAH); Reactive oxygen species (ROS); Non-alcoholic steatohepatitis (NASH); Methionine Cystathionine -β -synthase (CBS); 5-methyltetrahydrofolate (5-CH3-THF); S-adenosylmethionine (SAM); Methionine adenosyltransferase 1A (MAT1A); S-adenosine homocysteine hydrolase (AHCY).

Journal: Frontiers in Pharmacology

Article Title: Effect of gentiopicroside on endogenous formaldehyde homocysteine–pathway related proteins in rats with non-alcoholic steatohepatitis

doi: 10.3389/fphar.2025.1700101

Figure Lengend Snippet: The mechanism diagram of endogenous formaldehyde participating in one-carbon metabolism leading to homocysteine accumulation and causing NASH. Note: formaldehyde (Endogenous FA); Glutathione (GSH) Mitochondrial aldehyde dehydrogenase 2 (ALDH2); Formate; Tetrahydrofolate (THF); 5, 10-methylenetetrahydrofolate (5, 10-CH2-THF); Methylenetetrahydrofolate reductase (MTHFR); Homocysteine (HCY); S-adenosine homocysteine (SAH); Reactive oxygen species (ROS); Non-alcoholic steatohepatitis (NASH); Methionine Cystathionine -β -synthase (CBS); 5-methyltetrahydrofolate (5-CH3-THF); S-adenosylmethionine (SAM); Methionine adenosyltransferase 1A (MAT1A); S-adenosine homocysteine hydrolase (AHCY).

Article Snippet: ROS, GSH, MDA, SOD, SAH, SAM, GST, CAT, GSH, HCY were obtained from Jiangsu Enzyme Immunoassay Biotechnology Co., LTD. Their item numbers are MM-88564O1, MM-20251R1, MM-2037H1, MM-20387R1, MM-50456H1, MM-0248H1, MM-21254R1, MM-20447R1, MM-20251R1 and MM-50456H1. β-actin antibody (Proteintech, 20536-1-AP); ALDH2 antibody (Proteintech, 15310-1-AP); MAT1A antibody (Proteintech, 12395-1-AP); MTHFR antibody (Proteintech, 26591-1-AP); CBS antibody (Proteintech, 14787-1-AP); AHCY antibody (Proteintech, 10757-2-AP); PVDF membrane with a thickness of 0.45 μm (IPVH00010, Millipore); Universal total RNA extraction reagent (U7431, Suzhou Youyi Landi Biotechnology Co., LTD.) Taq SYBR® Green qPCR Premix (Universal) (EG0117M, Jiangsu Bishi Mei Biotechnology Co., LTD.) All-in-One First-Strand Synthesis MasterMix (with dsDNase) was obtained from Jiangsu Bestmate Biotechnology Co., LTD. (item number (EG15133S).

Techniques:

GNMT , MAT1A and MAT2A mRNA expression from a published RNA-seq data set. ( A ) No difference was observed in GNMT ( A ) or MAT1A ( B ) mRNA expressions between breast cancer tissues and normal tissues, and no association was found in these genes with overall survival rate. ( C ) The median of MAT2A mRNA expression level in breast tumorous tissues tended to be lower in breast cancer compared to that of the normal tissues; however, a longer survival rate was found in patients with lower MAT2A mRNA levels of the tumor tissue, ( D ) No association was found between MAT2A mRNA expression and tumor stages.

Journal: International Journal of Molecular Sciences

Article Title: MAT2A Localization and Its Independently Prognostic Relevance in Breast Cancer Patients

doi: 10.3390/ijms22105382

Figure Lengend Snippet: GNMT , MAT1A and MAT2A mRNA expression from a published RNA-seq data set. ( A ) No difference was observed in GNMT ( A ) or MAT1A ( B ) mRNA expressions between breast cancer tissues and normal tissues, and no association was found in these genes with overall survival rate. ( C ) The median of MAT2A mRNA expression level in breast tumorous tissues tended to be lower in breast cancer compared to that of the normal tissues; however, a longer survival rate was found in patients with lower MAT2A mRNA levels of the tumor tissue, ( D ) No association was found between MAT2A mRNA expression and tumor stages.

Article Snippet: MAT1A antibody (Novus, NBP2-33533) was purchased from Novus Biologicals, LLC, Inc. (Centennial, CO 80112, USA)., and MAT2A antibody (GTX50027; GeneTex) was purchased from GeneTex, Inc. (Alton Pkwy Irvine, CA, USA).

Techniques: Expressing, RNA Sequencing Assay

Relationships between clinical parameters, GNMT1, MAT1A protein expression, and MAT2A C/N ratio in 252 breast cancer patients.

Journal: International Journal of Molecular Sciences

Article Title: MAT2A Localization and Its Independently Prognostic Relevance in Breast Cancer Patients

doi: 10.3390/ijms22105382

Figure Lengend Snippet: Relationships between clinical parameters, GNMT1, MAT1A protein expression, and MAT2A C/N ratio in 252 breast cancer patients.

Article Snippet: MAT1A antibody (Novus, NBP2-33533) was purchased from Novus Biologicals, LLC, Inc. (Centennial, CO 80112, USA)., and MAT2A antibody (GTX50027; GeneTex) was purchased from GeneTex, Inc. (Alton Pkwy Irvine, CA, USA).

Techniques: Expressing

GNMT, MAT1A, and MAT2A immunohistochemical staining in selected cases of breast cancer (×200). ( A ) Low and high GNMT staining in breast cancer tissues and normal breast tissues. ( B ) Low and high MAT1A staining in breast cancer tissues and normal breast tissues. ( C ) Low and high MAT2A staining in breast cancer tissues and normal breast tissues. ( D ) GNMT is overexpressed in normal tissues versus breast cancer tissues. ( E ) MAT1A is overexpressed in breast cancer tissues versus normal tissues. ( F ) Cytoplasmic MAT2A is overexpressed in breast cancer tissues versus normal tissues. ( G ) No difference is observed in nuclear MAT2A expression between breast cancer tissues versus normal tissues.

Journal: International Journal of Molecular Sciences

Article Title: MAT2A Localization and Its Independently Prognostic Relevance in Breast Cancer Patients

doi: 10.3390/ijms22105382

Figure Lengend Snippet: GNMT, MAT1A, and MAT2A immunohistochemical staining in selected cases of breast cancer (×200). ( A ) Low and high GNMT staining in breast cancer tissues and normal breast tissues. ( B ) Low and high MAT1A staining in breast cancer tissues and normal breast tissues. ( C ) Low and high MAT2A staining in breast cancer tissues and normal breast tissues. ( D ) GNMT is overexpressed in normal tissues versus breast cancer tissues. ( E ) MAT1A is overexpressed in breast cancer tissues versus normal tissues. ( F ) Cytoplasmic MAT2A is overexpressed in breast cancer tissues versus normal tissues. ( G ) No difference is observed in nuclear MAT2A expression between breast cancer tissues versus normal tissues.

Article Snippet: MAT1A antibody (Novus, NBP2-33533) was purchased from Novus Biologicals, LLC, Inc. (Centennial, CO 80112, USA)., and MAT2A antibody (GTX50027; GeneTex) was purchased from GeneTex, Inc. (Alton Pkwy Irvine, CA, USA).

Techniques: Immunohistochemical staining, Staining, Expressing

Kaplan–Meier analysis of clinical data, GNMT, MAT1A, and C/N ratio of MAT2A protein expressions in breast cancer patients. ( A ) Overall survival estimates for stage. ( B ) Overall survival estimates for age. ( C ) Overall survival estimates for ER expression. ( D ) Overall survival estimates for PR expression. ( E ) Overall survival estimates for HER2 expression. ( F ) Overall survival estimates for C/N ratio of MAT2A expression. ( G ) Overall survival estimates for GNMT expression. ( H ) Overall survival estimates for of MAT1A expression.

Journal: International Journal of Molecular Sciences

Article Title: MAT2A Localization and Its Independently Prognostic Relevance in Breast Cancer Patients

doi: 10.3390/ijms22105382

Figure Lengend Snippet: Kaplan–Meier analysis of clinical data, GNMT, MAT1A, and C/N ratio of MAT2A protein expressions in breast cancer patients. ( A ) Overall survival estimates for stage. ( B ) Overall survival estimates for age. ( C ) Overall survival estimates for ER expression. ( D ) Overall survival estimates for PR expression. ( E ) Overall survival estimates for HER2 expression. ( F ) Overall survival estimates for C/N ratio of MAT2A expression. ( G ) Overall survival estimates for GNMT expression. ( H ) Overall survival estimates for of MAT1A expression.

Article Snippet: MAT1A antibody (Novus, NBP2-33533) was purchased from Novus Biologicals, LLC, Inc. (Centennial, CO 80112, USA)., and MAT2A antibody (GTX50027; GeneTex) was purchased from GeneTex, Inc. (Alton Pkwy Irvine, CA, USA).

Techniques: Expressing

Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; SAM, S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM synthase (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.

Journal: Scientific Reports

Article Title: Unraveling the role of quorum sensing-dependent metabolic homeostasis of the activated methyl cycle in a cooperative population of Burkholderia glumae

doi: 10.1038/s41598-019-47460-6

Figure Lengend Snippet: Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; SAM, S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM synthase (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.

Article Snippet: The blocked membrane was incubated with a rabbit polyclonal antibody against the N-terminal region of SAM synthase (MetK; NBP1-55120; Novus Biologicals, LLC, Centennial, CO, USA).

Techniques: Inhibition, Activation Assay, Expressing